SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010096 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010096
Domain Number 1 Region: 492-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000196
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 551-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000767
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010096
Domain Number - Region: 814-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000349
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 447-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00635
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 737-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0216
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010096   Gene: ENSDORG00000010743   Transcript: ENSDORT00000010743
Sequence length 849
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3057:39467:44428:-1 gene:ENSDORG00000010743 transcript:ENSDORT00000010743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHNPVSTTGTTSSLGHNAPSLPVDNCSSSTSDPVTKESPIAPSTSESMRPSEPGGEPL
ESGCGLIPPKETGEPQEEPGCGHFTPKDLGAGKNKSQEEEEEGLPPVDLSNHLFYTTSGE
AYLVAELSLPGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSRPQAFMSHTQHGKLTPAQHQSLGSPAMLQEEDKGCVVLLSYLEPKPLPCVLETP
FDNSSTENTEVNVPQIHDRPLEAEVQALVLPTEEVMASPPSPTITPATWDPSPTQAKESP
IAAGEAGPDWFPEGQEEDRGLCPQLNQSSPTSKEGGILPAPVGSPEDPNDPPQPYRLPDD
YTPAPAAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPESNSHCS
YCSAGGAHPRLARGESYNCGYKPYRCDVCNYSTTTKGNLSIHMQSDKHLANLQGFQVGPG
GQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKHMQNVLMLHQGL
PLGLPPGLVGPGPPPPPGAAPTNSPELFQYFGPQTLGQPQTPMPGPGLRPDKPLEAQLLL
NGFHHLGAPTRKFPTPAPDSLSPEAHLPPSQLLGSSSDGLATTPPPDDSPALKVFRCLVC
QAFSTDSLELLLYHCSIGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLKTDKHAQ
KYQLAAHLREGGGVLGTSSPLSLGDGAPYGSVSPLHLRCNICDFESNSKEKMQLHARGSA
HEENSQIYK
Download sequence
Identical sequences ENSDORP00000010096 ENSDORP00000010096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]