SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010236 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010236
Domain Number 1 Region: 377-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000569
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010236   Gene: ENSDORG00000010891   Transcript: ENSDORT00000010891
Sequence length 955
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3165:2357:56119:-1 gene:ENSDORG00000010891 transcript:ENSDORT00000010891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NDMAELFMECEEEELEPWQKKIKEVEDDDDDEPIFVGEIASSKPAISNILNRVNPSSYSR
GIKNGALSRGISAAFKSTSQHYTNPSNPVAASPVNFHPESRSSDSSVIVQPFSKPGYLTK
SSRVVSSNSSELLFDLTQDTELPQYQGIPTISVAXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXICKICELSFETEHVLLQHMKDNHKPGEMPYICQVCNYRSSSFSD
VETHFRTSHENTKNLLCPFCLKVIKIATPYMHHYMKHQKKGIHRCTKCRLQFLTCKEKID
HKTQHHRTFIKPKQLEGLPPGTKVTIRASVAPLQSGPSTTPSISASTSTLQLSPPRTENT
PAKSPTKLSTSKPDTTRSEASKPNGSKSKCKSKVSNIQKKQSTLVNSNKKSKVNTSLRNL
RCSRGVHKCIECSSEIKDFANHFPTYVHCGFCRYNTSCSKAYVNHMMSFHSNRPSKRFCI
FKKHSENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXEIARHTVAERKTETSSSESKQDEDSSSEEKNECDTDLSEGLSPT
KKEENVTDRENDACPAYQESSSKKVLSHDSDTGADKMEKEKQMHHNFQEKEQEMGQSSEN
IISCDQIKDHNSSGARFFSKNIKNLRLTSDDFLRKRDEPESVSSDVSEQSSVHLEPLTPS
EVLEYEATEIFQKGSGDPSAKTDDTVSDHADNTSREVSPSTPDKTVVLADKKERS
Download sequence
Identical sequences ENSDORP00000010236 ENSDORP00000010236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]