SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010255 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010255
Domain Number 1 Region: 449-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 81-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000194
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 497-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000067
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 587-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000246
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 678-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000104
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 6 Region: 740-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000362
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 7 Region: 541-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000414
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010255
Domain Number - Region: 117-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0096
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010255   Gene: ENSDORG00000010909   Transcript: ENSDORT00000010910
Sequence length 848
Comment pep:novel scaffold:dipOrd1:scaffold_40950:1422:9740:-1 gene:ENSDORG00000010909 transcript:ENSDORT00000010910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLQGSGKSGSGKGSGRKEARLPMLQDPLKRGMPVAHSGQTVPGQAPLCF
DPGNPTSDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKASRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRSLPAPKPGPVNRPV
TISRPVGVSKPIGVSKPVSIGKPVGVSKPIGISKPVTVSRPVPVSKAMPVTRPVPVTKLV
TVTKPVPVTKPVPVSRPVVVSKPVPVSRPIAISRHTQPCKMLLLTKSENKTPRATGKNSS
KKRAADSLDACPILPKQARSENGEFGPSSMGQSPTFQPSAGSSHSSALSGSRSSAGKELL
RSPGPLSSPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARVHRAKKQE
GPGADEVRKKVPATPITDCKESAAPVAHPAPGVPEEQWQRTIHERGEAVCPTCNVVTRKT
LVGLKKHMEVCQKLQEALKCQHCRKQFKSKAGLNYHTMAEHSAKATDAEASEGGEQEERE
RLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCAHCSKTYRSK
AGHDYHVRSEHTAPPSEEPTDKTPEAEDLGVERTPSGRIRRTSAQVAVFHLQEIAEDELA
HDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKSEVKEGHVNCLNDCCEAIYSSV
SGLKAHLASCSKGDHLVGKYHCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPTRHRG
QDSLMTRREKKKSLASGKKRGRKPKEWSPEESESKLPLHRDDWSPGARDKGARGCIGRKV
GAGKSPEK
Download sequence
Identical sequences ENSDORP00000010255 ENSDORP00000010255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]