SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010305 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010305
Domain Number 1 Region: 909-1126
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.06e-37
Family Ankyrin repeat 0.00064
Further Details:      
 
Domain Number 2 Region: 1172-1274
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-24
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 3 Region: 1291-1425
Classification Level Classification E-value
Superfamily TPR-like 5.31e-23
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Domain Number 4 Region: 362-445,559-631
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000307
Family Extended AAA-ATPase domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010305   Gene: ENSDORG00000010962   Transcript: ENSDORT00000010963
Sequence length 1857
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1941:7091:150945:1 gene:ENSDORG00000010962 transcript:ENSDORT00000010963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKAVLKKSREGGKGSKKETGGDFGPETPPILPPGLGGDSPVSSPPAAEDSYRVSLAKGV
SMSLPSSPLLPRQSHLAQSRSSKKSPGPVRKPKYVESPRVPGDAVIIPFREVSKPAEPSE
NEAKADNEPSCSPAAQELLTRLGFLLGEGIPSATHITIEDKNETMCTALSQGISPCSTLT
SSTASPSTDSPCSTLNSCVSKTAANKSPCETISSPSSTLESKDSGIIATITSSSENDDRS
GSSLEWNKDGSLRLGVQKGVLHDRRADNCSPVAEEETTGSADSVLPKAESSAGDGPVPYS
QSSSSLIMPRPNSVAATSSTKLEDLSYLDGQRNAPLRTSIRLPWHNTAGGRAQEVKARFA
PYKPQDILLKPLLFEVPSITTDSVFVGRDWLFHQIEENLRNTELAENRGAVVVGNVGFGK
TAIISKLVALSCHGSRMRQIASNSPSSSPKTSDLTQDLPFTPLLSPSSSTSGLSTVKTAA
GANTSENQRPKEDSVKSLASKVVAYHYCQADNTYTCLVPEFVHSISALLCRSHQLAAYRD
LLIKEPHLQSMLSLRSCVQDPVAAFKRGVLEPLTSLRNEQKIPEEEYIILIDGLNEAEFH
KPDYGDTLSSFITKIISKFPAWLKLIVTVRTNFQEIISSLPLAKLSLDDFPDNKDIHSDL
HAYVQHRVHSSQDILSNISLNGKADAALIGKVSSHLVLRSLGSYLYLKLTLDLFQRGHLV
IKSASYKVVPVSLSELYLLQCNMKFMTQSAFERALPILNVALASLHPMTDEQIFQAINAG
HIQGEQGWEDFQQRMDALSCFLIKRRDKTRMFCHPSFREWLVWRADGENTAFLCEPRNGH
ALLAFMFSRQEGKLNRQQTMELGHHILKAHIFKGLSKKTGISSSHLQALWIGYSTEGLSA
ALASLRNLYTPNVKVSRLLILGGANVNYRTEVLNNAPILCVQSHLGHEEVVTLLLEFGAC
VDGVSENGMTALCYAAAAGHMKLVCLLTKKGARVDHLDKKGQCALVHSALRGHGDVLQYL
LTCEWLASPSQPGTLRKSQALQQALTAAASMGHSSVVQCLLGMEEEHEIEVNGTDTLWGE
TALTAAAGRGKLEVCELLLEQGAAVSRTNRRGVPPLFCAARQGHWQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAALSSLDKEGLSALSWACLKGHKTVVQYLIEE
GAEIDQTDKNGRTPLDLAAFYGDAETVLYLVDKGAVIEHVDHSGMRPLDRAIGCRNTSVV
VTLLRKGAKLGNAAWAMATSKPDILIILLQKLMEEGNVMYKKGKMKEAAQRYQYALRKFP
REGVGEDMRPFNELRVSLYLNLSRCRRKTNDFGMAEEFASKALELKPKSYEAFYARARAK
RNSRQFVAALADLQEAVKLCPTNQEIKRLLARVEEECKQLQKSQQQKQQCPPPAPPNDSD
HEEDTPTSELNDHFHLEEADEEETSPQEESISPPPRSQPPSSVPSPYIRNIQEGLQSKGR
PVSPQSRAGTSKASRETVAQPGLVMQPTKAQIVKTKQHLGSGQCAVRSNSTKMQVSSQHP
PPSPMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSSIKMSSSTNS
LTSSSSFDGFKVQGPDTRLKDKTINQVQSGTAEHRPRNTPFMGIMDKTARFQQQSNPPNR
TWHCQVAEGLLTNTAAAAGLQPSNSEKPSLKPGYSHQAKPSSVSTLGGSVHNGAPVKELE
ENKCQIPVHCPDIRISKSVSHLYQESIPKQPPHSTNEAHRSHLTSAKPKRSFIESNV
Download sequence
Identical sequences ENSDORP00000010305 ENSDORP00000010305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]