SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010328 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010328
Domain Number 1 Region: 239-456
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.7e-61
Family Ankyrin repeat 0.00000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010328   Gene: ENSDORG00000010986   Transcript: ENSDORT00000010987
Sequence length 480
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_989:16449:23494:-1 gene:ENSDORG00000010986 transcript:ENSDORT00000010987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWRGESGGNGREDSELRAAKGDSGGAWPVPGSARRGRGGARRWPGGAGRAGPDWARLPVT
AGWARPVSRLSSAPRAGPSHAHRVERPRGVGRRLCEADPPPGKARRRREPDPARTQPPAG
AAGMSEARKGADEADEGQCDSGIESLRSLRSLPEPGPAPASARGGGPQPRTPPPGTDGEP
PEKGDAERADSTYGSSSLTEPLPLLGGPGTDDPAPGSALPPAGTLSPQQLEALTYISEDG
DTLLHLAVIHEAPTVLLCCLALLPQEVLDIQNNLYQTALHLAVHLDQPGAVQALVLKGAS
RVLQDRHGDTALHVACRRQHLACARCLLQGQPEPGREPPHSLDLQLQNWQGLACLHIATL
QKNQPLMELLLQSGADIDAQEGTSGKTALHLAVETQERSLVQYLLQAGARVDARMLNGCT
PLHLAAGRGLRAISSTLCEAGADSLLLNVEDETPQDLADPLTLLPFDDLKISGKPLLCVD
Download sequence
Identical sequences ENSDORP00000010328 ENSDORP00000010328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]