SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010382 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010382
Domain Number 1 Region: 191-496
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.83e-79
Family NAD kinase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010382   Gene: ENSDORG00000011044   Transcript: ENSDORT00000011045
Sequence length 513
Comment pep:novel scaffold:dipOrd1:scaffold_15357:12572:28216:1 gene:ENSDORG00000011044 transcript:ENSDORT00000011045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEHEKMSVSKELSPDSAFCCAACHGGETWSPSHPLRGRAKSRSLSASPAPGSTKEFRR
TRSLHGPSPVTTFGPKACVLQNPQTIVAQEEVEELVCGHERLAPRPVEDSGGGSALRLRP
RLELGRPRHIQDPGSQRLTWNKSPKSVLVIKKIRDASLLQPFKELCVYLMEASRAGRAAC
GEPGPRVTSHLRACLQENNMIVYVEKKVLEDPAIASDENFGPVKKKFCTFREDYDDISNQ
IDLIICLGGDGTLLYASSLFQSVPPVMAFHLGSLGFLTPFNFENXXXXXXXXXXXNAAVV
LRSRLKVRVVKELPGKKAALHNGLSENGLPGTGAEAGKQAMQFQVLNEVVIDRGPSSYLS
NVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIMVTPICPHSLSFRP
IVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIHHGDSISITTSCYPLPSICVRDPVSDW
FESLAQCLHWNVRKKQAHFTEEEDGDGGVREDG
Download sequence
Identical sequences ENSDORP00000010382 ENSDORP00000010382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]