SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010387 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010387
Domain Number 1 Region: 162-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-18
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-16
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 212-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000132
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010387   Gene: ENSDORG00000011051   Transcript: ENSDORT00000011051
Sequence length 372
Comment pep:novel scaffold:dipOrd1:scaffold_35060:1323:5399:1 gene:ENSDORG00000011051 transcript:ENSDORT00000011051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPVTFVDVAVTFTLEEWALLDSPQKKLHRHVMWETLRNLAAVGTKQNEESIEHGCKTLRR
NLSRERSHSREKPSANKSSDQAHPGLSSVPRHESTAKGGSPQRKARGEAFTRTSAHTEET
PSVSEEHGEASGLAKCFHSRGGSPRDGPAHHGKPGGEVRQSGEKRYGCQQCGKSFSYRFY
VKIHERIHSGEKPYGCQQCEKAFTSSSHLHRHARTHTGEKPCKCKQCGKVFSRISHLRAH
SRAHSGGELCACEHCKVLCFLQQLQRQQRTGSGEKHYVCPAARPSVNLTSFEDTSGLTTG
RSPTCVSTVGKPSVVVRTKPTIGPTPSRSLISASSGKASSVPVTCGGTDRRTPERKVAYV
GSVGWLLVKFFM
Download sequence
Identical sequences ENSDORP00000010387 ENSDORP00000010387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]