SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010401 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010401
Domain Number 1 Region: 296-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-19
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 340-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000038
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 259-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000269
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010401   Gene: ENSDORG00000011068   Transcript: ENSDORT00000011068
Sequence length 377
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_115:16103:17302:1 gene:ENSDORG00000011068 transcript:ENSDORT00000011068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASENIIYITTENAEFPADILEVGGGGAVEGLPEEALTVYQDLSGDWAHGGHYDSPLIAL
QPLGIGSLSHGDHDQEVIVVQTREEVVTCHDSECVPAIHEIFDQVPIPCPDIDDDFEQTL
AALAASMESATTTIPGFSYEHQDNQELSSNSTTQKESNQTEEGTSSQVSDGIRTWGQEQV
QFPNLEGEFSITMWATSEKSEPESPKEAESSPPDYSEYLMGKKFPPGGIPGVDLSDPKQL
AEFTSMKQKKLKEDGPRTTPCAHPGCVKMFKDTAAMKKHLHIHGPRVHMCAECGKAFVES
SKLKRHQLVHTGEKPYQCIFEGCGKRFSLDFNLRTHVRIHTGDRPFACPFHTCNKKFAQS
TNLKSHILTHTKNMHNH
Download sequence
Identical sequences ENSDORP00000010401 ENSDORP00000010401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]