SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010426 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010426
Domain Number 1 Region: 550-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-17
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 2 Region: 606-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000622
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 510-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000181
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 417-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 478-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000565
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010426   Gene: ENSDORG00000011096   Transcript: ENSDORT00000011096
Sequence length 681
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_42:947:17169:1 gene:ENSDORG00000011096 transcript:ENSDORT00000011096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDGLELQPQEPNSFFDVTGAGATHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDP
DSVVIQDVIEDVVIEDVQCPDIMDEADVSETVIIPEQVLDSDVTEEVSLTHCTVPDDVLA
SDITSASMSMPEHVLTGESIHVSDVGHIEHVVHDNVVEAEIVTDPLTTDVVSEEVLVADC
ASEAVIDANGIPVDQQDDNKNNCEDYLMISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGTVDIVESEENDHAVELLDQNNTVRVPREKMVYMAVNDS
QQEDEEINVAEIADEVYMEVIVGEEDAAAAAAAAVHEQQIDNSEMKTFMPIAWAAAYGNN
SDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGHPLTVYPC
MICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKSEKT
TECDDCGKHFSHAGALFTHKMVHKEKGANKMYKCKFCEYETAEQGLLNRHLLAVHSKNFP
HICVECGKGFRHPSELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMPFKC
DVCLLTFSDTKDVQQHALIHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMC
DKGFHRPSELKKHVPAHKKMH
Download sequence
Identical sequences ENSDORP00000010426 ENSDORP00000010426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]