SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010584 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010584
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-25
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 525-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 623-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010584   Gene: ENSDORG00000011266   Transcript: ENSDORT00000011264
Sequence length 681
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6326:5390:8192:-1 gene:ENSDORG00000011266 transcript:ENSDORT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVTFRDVAIDFTQEEWKQLDPAQRDLYRNVMLENYNNLITVGYPVAKPDVIFKLEQEEE
PWVVEDEVLRRHCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAFSHKKNF
ITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNLIAHE
KIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNKCGKAFSQIASLTLHLRSHT
GEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKP
YECNKCGKAFSQSSSLTIHIRGHTGEKPFDCTKCGKAFSQISSLTLHMRKHTGEKPYHCL
ECGKAFSQKSHLVRHQRIHIH
Download sequence
Identical sequences ENSDORP00000010584 ENSDORP00000010584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]