SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010589 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010589
Domain Number 1 Region: 84-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 122-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010589   Gene: ENSDORG00000011269   Transcript: ENSDORT00000011269
Sequence length 283
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4707:100117:101307:1 gene:ENSDORG00000011269 transcript:ENSDORT00000011269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSEMGSEKEQSPEPHLPEEGEEGKPWRVDGSEGSRIPPGEEHGQESLLKGAQGTHPKKPW
QKVTAPARGPKDPIAHPRPVEDEKPFVCAQCGKTFNNTSNLRTHQRIHTGEKPYKCSECG
KSFSRSSNRIRHERIHLEEKHYKCPECQESFRRRSDLTTHQQDHLGKRPYRCDICGKSFS
QSATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXCGKHFSRSSNCAPFIRLRRMICCLG
Download sequence
Identical sequences ENSDORP00000010589 ENSDORP00000010589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]