SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010603 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010603
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 32-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 308-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 10 Region: 727-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010603   Gene: ENSDORG00000011286   Transcript: ENSDORT00000011283
Sequence length 788
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3766:2807:20695:-1 gene:ENSDORG00000011286 transcript:ENSDORT00000011283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALPSRPCTYLQRDMEVHVGADHITLNRVVLLQFSVSFEDVTVDFSKEEWQSLDHGQRR
LYWDVTLENYCHLLSVGYHIAKTETVFKLGQEEEPWTPEEEAPQESCLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXEEEPHLCTQCGKSFTLKSNLTTHQKIHTGHKPFKCNECGKAFLQKSDLFRHLKIHT
GEKPYECSECGKAFFQKSDLFRHLRIHTGEKPFECNECGRGFSQNSDLSVHLRTHTGEKH
YECRECGKAFTRKSTLKMHQRIHTGEKPYVCMECGQAFIQKSHFNMHWRIHTGEKPYECS
DCGKSFTKKSQLHVHRRVHTGEKPYVCTECGKVFTHRTNLTTHQKTHTGEKPYICAECGK
AFSDHSNLIKHQKTHSREKPYECNGCGKAFVWKSRLKIHQKSHMGERHYTCKECGKAFIQ
KSTLNVHQRIHTGEKPYICPECGKGFIQKSHFIVHHRIHTGEKPYECSDCGKCFTKKSQL
RVHQKIHTGEKPYVCAECGKAFTDRSNLIAHQKIHTREKPYKCSDCGKSFTWKSRLSVHQ
RSHTGERHYGCSKCGKVFMQKATLSMHQLIHTGKKPYSCTECQKAFTDRSNLIKHQKTHS
GEKCKAIE
Download sequence
Identical sequences ENSDORP00000010603 ENSDORP00000010603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]