SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010613 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010613
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-28
Family G proteins 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010613   Gene: ENSDORG00000011294   Transcript: ENSDORT00000011292
Sequence length 166
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2033:12415:16332:1 gene:ENSDORG00000011294 transcript:ENSDORT00000011292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSVDGRPVRLQLCDTAGQDEFDRLSPYTNADIFLLCFNVVSAFQDVSEKWVPEIRCHCP
KAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLK
EVFDAAIVAGIQHSDSQQQPKKCKSRTPDKVRDLSKSWWRKYCCLA
Download sequence
Identical sequences ENSDORP00000010613 ENSDORP00000010613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]