SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010714 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010714
Domain Number 1 Region: 774-1032
Classification Level Classification E-value
Superfamily SET domain 1.44e-85
Family Histone lysine methyltransferases 0.0000322
Further Details:      
 
Domain Number 2 Region: 515-754
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.31e-60
Family Ankyrin repeat 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010714   Gene: ENSDORG00000011397   Transcript: ENSDORT00000011400
Sequence length 1072
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6609:28577:45725:-1 gene:ENSDORG00000011397 transcript:ENSDORT00000011400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPSVQSLAMRLLSMPGSQGTSATGPEPPPATTTPEGQPKVHRARKTMSKPGNGQPPVPE
KRPPEVQHFRMSDDVHSLGKVTSEVAKRRKLNSAGGLSEELNSARGSGEVSLDKGHPRSL
EEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALAEQLSEEEEEEEEEEEEEEEEEEEE
EEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKELRGVNGVSS
SGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRI
SERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCG
YFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPA
GTVAPAPPPLAQDAPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCL
SAVGLPPGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNF
QSDQQSKRTALHAAAQKGSLEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLDVARYMV
QRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQXXXXXXXXIWAAEHKHI
DVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIA
ARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRT
EKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVD
DCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKV
RLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYC
IDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRF
WDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPELGSLPPANT
Download sequence
Identical sequences ENSDORP00000010714 ENSDORP00000010714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]