SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010828 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010828
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 183-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000844
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 87-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000843
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000357
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010828   Gene: ENSDORG00000011524   Transcript: ENSDORT00000011523
Sequence length 499
Comment pep:novel scaffold:dipOrd1:scaffold_7917:13805:15835:-1 gene:ENSDORG00000011524 transcript:ENSDORT00000011523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCTQQDCTKAFVSKYKLQRHMATHSPEKSHKCNYCEKMFHRKDHLKNHLHTHDPNKET
FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGV
KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQS
SGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKDQPLKGEIESYL
MELQGGMPSSSQDSQASSSKLGLDPQSGSLDDGAGDLSLSKSSISISDPLNTPALDFSQL
FNFIPLNGPPYNPISVGSLGMSYSQDEAHSSVSQIPSQSQDLQDPANAIGLGSLHSLSAA
FTSSLSTSTTLPRFHQAFQ
Download sequence
Identical sequences A0A1S3EK31
ENSDORP00000010828 ENSDORP00000010828 XP_012864743.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]