SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010830 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010830
Domain Number 1 Region: 7-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-51
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 352-396,431-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010830
Domain Number - Region: 258-283,327-374
Classification Level Classification E-value
Superfamily TPR-like 0.00278
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010830   Gene: ENSDORG00000011526   Transcript: ENSDORT00000011525
Sequence length 617
Comment pep:novel scaffold:dipOrd1:scaffold_38114:27:14731:1 gene:ENSDORG00000011526 transcript:ENSDORT00000011525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKNTVFNAARDGNLRMLTNMLTSKSKEEVSSLMAEKTHGASPLVVAARYGHKDMVEFL
LEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLSHGAAVNNTTLTNSTPL
RAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSV
KGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQTS
KTERINALELLGATFVDKKRDLLGALKYWKKAMTMRYSDRTNVISKPVPQTLIMAYDYAK
EANSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINL
WKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVL
EIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGK
NNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAAINNH
PDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIH
YKGHIPEKLETFVSLHR
Download sequence
Identical sequences ENSDORP00000010830 ENSDORP00000010830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]