SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010849 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010849
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 152-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000571
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 221-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000496
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010849
Domain Number - Region: 123-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00299
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010849   Gene: ENSDORG00000011547   Transcript: ENSDORT00000011545
Sequence length 263
Comment pep:novel scaffold:dipOrd1:scaffold_24820:16363:18153:1 gene:ENSDORG00000011547 transcript:ENSDORT00000011545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADGACSERRGPAVPVHSPDREAPPVPSQPWNCASAIPRLSLPLLPCHEEALGPSRPEPLD
VSWTGPRAGSTPSVALRASLNHLNLPLLLPPPTQWPPIPGPDGDGAPDKPLKDQGMSRVP
GGFECTHCHRPYHTPAGLARHQQLHCHLPAGRPFTCRYCDKVYASLGALKMHIRTHTLPC
ICKVCGKAFSRPWLLQGHARTHTGEKPYACLHCSRAFADRSNLRAHLQTHSGTKKYQCKG
CSKTFSRMSLLARHEEASCRPGP
Download sequence
Identical sequences ENSDORP00000010849 ENSDORP00000010849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]