SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010864 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010864
Domain Number 1 Region: 1516-1666
Classification Level Classification E-value
Superfamily BRCT domain 1.02e-45
Family 53BP1 0.0000000706
Further Details:      
 
Domain Number 2 Region: 1339-1386
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.72e-21
Family Tudor domain 0.0000829
Further Details:      
 
Domain Number 3 Region: 1286-1338
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.73e-18
Family Tudor domain 0.0000693
Further Details:      
 
Domain Number 4 Region: 1668-1742
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000301
Family 53BP1 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010864   Gene: ENSDORG00000011558   Transcript: ENSDORT00000011560
Sequence length 1761
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5130:68434:128441:-1 gene:ENSDORG00000011558 transcript:ENSDORT00000011560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DESASHFTMLSRHLPNLQMHKENPVLDVGSNPEQTSAEPQEDSNSGFREQLRENKSEGPV
DSSHLETSGSLSQVIDQLPQPNRTSSVLGMAVESGPAVEEEKEELEDLEKEAEEEHPLDQ
TTRSFCAEDSASSQMGFGVLELSQSQDVEEQTVPYEIVQEHLEPITTNAGHMLSEVDAND
AVKLEEQSREEIAVSEQPSKDILVIPQPSKSVYALEEHGSPPAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXQEDLFDQSNKTVASDGCSTPSREEAGCSLAST
PATTLHLLQLSGQRSSIVQESLSTNSSDLVAPSPDVFRPTPLIVPSSTEQEGRKDEPMDM
SVLPEGRSESFQQKPDRDEAVEVENPPLPLEPTILPQASTPVCQSTPVFTPGSLSIPSQP
EFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPK
RHSTPIDISNYPESTIATSDVMSESMVETNDPILTSEKGDSGSVPEMDDKLCLRMKLVSP
ETEASEESLQFSLEKPVTSERKNGSAALAEAVASPQKTMSVLSCIREAQRADEAGGEEGC
AAPAGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEP
IVECQECEAEVCPSHTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGRGAGP
LRGKSSATEPTDFAFPSSRGGPGKLSPRKGVSQTGAPVCEEDGDGIRQGGKAPVTPRGRG
RRGRPPSRTTGTRETVVSGPLGIEDISPSMSPDDKSFTRIVPRVPDANRRADVGASTLRR
SDSPEIPFQTAASSADGVDASSPGSSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLF
DDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRK
WYKRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGKRKLITSEEERSPAKRGRKSTTVKPGAVGAGDF
VSPCESGDNTGEPSVLEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSS
EEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCL
ASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFHNLKVLLVSD
QQQNFLELWSEILMTGGAASVKQHHSSAHNKVFFLDLLEIVLSCPGALNCAEALQLPVVS
PEVQLGERSKQHKYKHDYVSH
Download sequence
Identical sequences ENSDORP00000010864 ENSDORP00000010864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]