SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010886 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010886
Domain Number 1 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 265-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 170-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 560-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000128
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010886
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00183
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010886   Gene: ENSDORG00000011582   Transcript: ENSDORT00000011583
Sequence length 619
Comment pep:novel scaffold:dipOrd1:scaffold_12600:24438:27959:-1 gene:ENSDORG00000011582 transcript:ENSDORT00000011583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYGNVASLGLPLLKPAVISQLEEGDELVGPFPLATGTGMGSWDFWTDVDVQTGSNLT
KEMYEEKDSRLVEVHRDFSQETDFSADCVLGQQQELHAAGCVKRENSSTADGTVKDEMSL
PEECPTSQSPNLLQCPTICPGERHPECTGVRRAFGLEKKLIKEXXXXXEKPYQCTDCGKA
FSINAELIWHQRLHSGGKPFKCVECGKCFSYSSHYITHRAIHSGEKPYQCKVCGKAFSVN
GSLSRHQRTHTGEKPYQCQECGSGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLV
QHQRIHTGEKPYECSECGKGFRCSSQLRQHQSVHTGEKPFQCQECEKAFSNNAKLIQHQR
IHTGEKPYGCSECGKAFSVKGKLIQHQRIHTGEKPYLCRECGKAFRCNSQLRQHMRTHTG
EKPYECHECGKAFSVNAKLMQHQRIHTGEKPFQCNECGKCFTSKRNLLDHHRIHTGEKPF
QCKQCGKAFSINAKLTRHQRIHTGEKPFKCVECEKAFSCSSDYIVHQRIHTGEKPFQCKE
CGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDCIIHQTVHTWKKPYVCSVCRKA
FRFSFQLNQHQNVHNDAKA
Download sequence
Identical sequences ENSDORP00000010886 ENSDORP00000010886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]