SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010887 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010887
Domain Number 1 Region: 187-477
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.81e-66
Family Ankyrin repeat 0.0000126
Further Details:      
 
Domain Number 2 Region: 494-628,655-772
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.06e-61
Family Ankyrin repeat 0.0000729
Further Details:      
 
Domain Number 3 Region: 1105-1308
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.4e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.002
Further Details:      
 
Domain Number 4 Region: 1026-1087
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000607
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Domain Number 5 Region: 882-933
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000933
Family Ankyrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010887   Gene: ENSDORG00000011584   Transcript: ENSDORT00000011584
Sequence length 1326
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5444:17633:158105:1 gene:ENSDORG00000011584 transcript:ENSDORT00000011584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTAGGLVPFASPR
HGLALPEGDGSREPPDRPRSPDPVDSTGCCSSTSSTVCTVSAVTGVPVASVSSAVGVAPK
PAGGGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSTTTTLGPGAAGPGTGVPAV
SGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMG
ANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCI
VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLN
VNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTE
LLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPE
LRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQ
VTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAA
LAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASK
AGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLV
PLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVDIAALLIKYNTCVNAT
DKWAFTPLHEAAQKGTQLCALLLAHGADPTMXXXXXXXXXXXXXADDIRALLIDAMPPEA
LPTCFKPQTVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE
GEVAGLDMNISQFLKTLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIK
GVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGI
FNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERH
AYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFL
QFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIVKPEAPSQTST
AAEQKT
Download sequence
Identical sequences ENSDORP00000010887 ENSDORP00000010887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]