SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010901 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010901
Domain Number 1 Region: 313-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.54e-16
Family PHD domain 0.0041
Further Details:      
 
Domain Number 2 Region: 205-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000757
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 266-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000014
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010901   Gene: ENSDORG00000011600   Transcript: ENSDORT00000011600
Sequence length 391
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3907:23847:38574:1 gene:ENSDORG00000011600 transcript:ENSDORT00000011600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVENVVKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRILEPDDFLDDLDDEDYEEDTPKRR
GKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNLCGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Download sequence
Identical sequences ENSDORP00000010901 ENSDORP00000010901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]