SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010913 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010913
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 416-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 317-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 44-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000745
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000236
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 181-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000599
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010913   Gene: ENSDORG00000011612   Transcript: ENSDORT00000011613
Sequence length 583
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2672:3730:10442:1 gene:ENSDORG00000011612 transcript:ENSDORT00000011613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVQDPACLQELEFPFSSKHHPCPQNLHLIAWRGLEPCTPSIVASQESVTFQDVAVDFTE
KEWPLLDSSQRKLYKDVMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXERAEKSSDYANLFEVLSMGPHLPQPMGSSAVK
RPYHHYTCGISFKTRTHPAQHVSVYDGRKMHECHQCQKAFTTSASLTRHRRIHTGEKPYE
CGDCGKAFNDPSALRSHARTHLQEKPFDCSQCGNAFRTLSALKIHMRVHTGERPYKCEEC
GKAYGRSCHLIAHKRTHTGERPYECRDCGKAFQHPSHLKEHVRNHTGEKPYACTQCGKAF
RWKSNFNLHKKNHLVQKTYQCKECGKSFGDLLSRRKHMRLHIVKKPVECHQCGKNFRNQS
ILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYECTACGKVFGDYLSRRR
HMSIHLVKKRVECRQCGKAFRNQSTLRTHTRSHTGEKPYECDHCGKAFSIGSNLNVHRRI
HTGEKPYECLSCGKAFSDHSSLRSHLKSHRGEKLFVPSVWKRL
Download sequence
Identical sequences ENSDORP00000010913 ENSDORP00000010913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]