SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011086 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011086
Domain Number 1 Region: 37-136
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-23
Family Ankyrin repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011086   Gene: ENSDORG00000011794   Transcript: ENSDORT00000011793
Sequence length 154
Comment pep:novel scaffold:dipOrd1:scaffold_8197:92:778:-1 gene:ENSDORG00000011794 transcript:ENSDORT00000011793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRTVRYSHYSPQQRRRRLLADRSVRFPNDVLFLDHIRQGDLAQVGRFIRARKVSLDTI
HPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDETGWTSLHMACSDGYPDIARYLISLG
ADRAAANDDGALPSDLIDPDFQDLLELFRGASMG
Download sequence
Identical sequences ENSDORP00000011086 ENSDORP00000011086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]