SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011093 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011093
Domain Number 1 Region: 55-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000765
Family HkH motif-containing C2H2 finger 0.021
Further Details:      
 
Domain Number 2 Region: 126-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000065
Family HkH motif-containing C2H2 finger 0.012
Further Details:      
 
Domain Number 3 Region: 233-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family HkH motif-containing C2H2 finger 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011093   Gene: ENSDORG00000011801   Transcript: ENSDORT00000011800
Sequence length 289
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5396:2978:33556:-1 gene:ENSDORG00000011801 transcript:ENSDORT00000011800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLQHPGLPPPKQPSSSPPMSVATRSTGTLQLLPQKPFEQAASLPLAGEEELPKGGETD
SALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNAVEPA
ATPILPVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSDSSEVGQRRSRKEANEFKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEIEFRQHLESKQHKSKVSEQRYRNEMENLGYV
Download sequence
Identical sequences ENSDORP00000011093 ENSDORP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]