SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011098 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011098
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 129-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011098
Domain Number - Region: 363-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0117
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011098   Gene: ENSDORG00000011805   Transcript: ENSDORT00000011805
Sequence length 416
Comment pep:novel scaffold:dipOrd1:scaffold_21042:14636:20491:-1 gene:ENSDORG00000011805 transcript:ENSDORT00000011805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGPDGDQNGLDHPSVE
VSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASA
YERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSNKKMWG
VLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLP
RDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSAQAVVSAV
SATIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPTLPVQDP
QLLHHCQHCDMYFADILYTIHMGCHYENPFQCNICGCKCKNKYDFACHFARGQHNQ
Download sequence
Identical sequences ENSDORP00000011098 ENSDORP00000011098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]