SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011104 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011104
Domain Number 1 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 102-163
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000071
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 297-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000257
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011104   Gene: ENSDORG00000011810   Transcript: ENSDORT00000011811
Sequence length 435
Comment pep:novel scaffold:dipOrd1:scaffold_11084:4656:12025:1 gene:ENSDORG00000011810 transcript:ENSDORT00000011811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAGNRSQLLATKMLSEQTTALGTGWESMNVQLDGAAPHEERGSPEEGTWRTAPGPLEHP
CHNLEEEPQSLQEKTQSASWVAIPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEE
WRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGEEQWVPDPQDLEERDILK
VTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEQNESWESTPRSSRGMLLGPPFL
QEESFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGR
RHHLIRHQKTHLHDKPSRCSECGKNFRCSAHLASHQRVHAEGKTCKGQEDEEGPGARKRQ
RAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQ
GQSPRSTWDRGASVF
Download sequence
Identical sequences ENSDORP00000011104 ENSDORP00000011104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]