SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011114 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011114
Domain Number 1 Region: 194-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 169-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000487
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011114   Gene: ENSDORG00000011823   Transcript: ENSDORT00000011822
Sequence length 312
Comment pep:novel scaffold:dipOrd1:scaffold_2941:31963:34830:1 gene:ENSDORG00000011823 transcript:ENSDORT00000011822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPH
VHEITRSTITEMAAAQGLVDTRFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN
LAVAATQEDPPKIGDLSKLSPGLGSPISGLTKLTPDRKPSRGRLPSKTKKEFICKFCGRH
FTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS
RTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCERCGKVFRRNCDLR
RHSLTHTPRQDC
Download sequence
Identical sequences A0A1S3EVE4
ENSDORP00000011114 XP_012867890.1.60039 ENSDORP00000011114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]