SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011165 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000011165
Domain Number - Region: 19-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000745
Family Classic zinc finger, C2H2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011165   Gene: ENSDORG00000011876   Transcript: ENSDORT00000011876
Sequence length 1168
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5243:6440:61457:1 gene:ENSDORG00000011876 transcript:ENSDORT00000011876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYAEKENSIAKALEDLKANFYCELCDKQYYKHQEFDNHINSYDHAHKQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPGSGPMFKSTTVTVRENCNEFPQSVVV
DSVNNQQDFKCTLQHSEENTKDVTTVPVDSGSTNNYTARNNQPGDQAQGIHRHKIGFSFA
FPKKASMKLESSAAAFSEYNDDASVEKEFSRKSRFVPSTCHLQLSPATDVLLNSEEKANS
FHPAEVMHTDKETAHTQEIKEVSSENGTLSLPSFCQLQLPLSSYADNCQNSVPLMDQISL
EEVTINEDIPVSSDSSELSENKSTVLEASDDCILGQAATEENVKSNESTIENENKNCLEP
LASLNIGEDNTTLHKKSHLCKRQCEPFVPVLNKHGTTVLPWPSEMLVYTTTEPSISYSCN
PLYFDFKSKLKNHLEKDKLPLDDSYSQQKEDATKGPVSDHRGISTAGLSDCEIFSSKNEH
NQVAPILADDSPFKNCDSGKNETLVQKYKNISYRTRKADKYNATKSHAKQDTLDEKYNKI
RLKDAHEHWFHKSRRKKRRRKLCHYHHGEKTKESETHDKMEMENHYTDTTRKNLPDPISE
KQYVAAEQLLDSCELPDQRPELASTDVSENEEMWKSWTGQCNDKEAISSINHRKQYLVSS
HDQSNPTLIHSGEQSLTYSRTYCCWKARLSSCSQDHKCLVLEKDTKCVNQNPPVKRGYNS
LVSESERFHRKRRQHSCSYSSDESLNRQNYLPEEFSRPSSASFALCRPKKKRRRKRSRFY
PRGETLEVKENTENPMKGNPSLSHLDGLIISEDKKEETKPQEVANVERNSQQSEKVNDQL
VFHPGNLLPSEANGEAGPLLMESTPGVLPEASHDSPTPPYVANVPTKQPTDNTLLEHKGR
SETKSIRGKQIPFKVPKTERNFRQPQPKSYLCHYELAEALPHGKMNEASTEWLCYNSGIL
NTQPPLPFKEAHVTGHTFVTTEQILAPLALPEQALLIPLENHEKFKNLPCEVYQHIIQPN
MLANKVKFTFPATPLPPPSTPLQPLPLQQPLCSTSVTTIHHTVLQQHAAAAAAAAAAAAA
AGTFKVLQPHQQFLSQVPTLTRTSIPQISVGPRLCPGNQPPFVAPAQMPILPASVLHPSH
LAFPPLPHALFPSLLSPHPAVIPLQPLF
Download sequence
Identical sequences ENSDORP00000011165 ENSDORP00000011165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]