SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011173 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011173
Domain Number 1 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.08e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 336-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011173
Domain Number - Region: 121-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00782
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011173   Gene: ENSDORG00000011889   Transcript: ENSDORT00000011885
Sequence length 611
Comment pep:novel scaffold:dipOrd1:scaffold_38818:4684:9844:-1 gene:ENSDORG00000011889 transcript:ENSDORT00000011885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLVFKPELISRLEKGQDPWVLDLQRTEGTETPQTSQTDSASRTDGEQACADMSILKPQS
PGCGDSSSSEVWLGSHPCSHRLRVKGCLSQRHCLPKETVASKTLLSYQLNEQQRDSVEGT
PQRCEVCGRCFRPTSDPASQWEVHAQKPNRCQGCYERLSDCLQSNYSSNFNGEKPYECED
CGKVFRLCSQLSQHQRIHTGEKPFKCVECGKAFRLSSKLIQHQRIHTGEKPYRCEECGKA
FGQSSSLIHHQRIHTGERPYSCRDCGKAFSQQSQLVRHQRIHTGERPYPCQECGKAFSQS
STLTQHQRMHAGEKLQITSDSESPGFLAHQRSHVEKPFKCEECGKAFRWISRLSQHQLIH
TGEKPYKCNKCTKAFGCSSRLIRHQRTHTGEKPFKCDECGKGFVQGSHLIQHQRIHTGEK
PYVCSDCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSMSTQLTIHQRVHTGERPYKC
SECGKAFSQNSTLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQRIHTRAQWYYEFGNT
LEGSTFVSRKKVNTVKKVHQCDDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSS
RLTQHQKIHME
Download sequence
Identical sequences ENSDORP00000011173 ENSDORP00000011173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]