SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011218 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011218
Domain Number 1 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 1-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 176-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011218   Gene: ENSDORG00000011934   Transcript: ENSDORT00000011933
Sequence length 400
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6109:93282:97200:1 gene:ENSDORG00000011934 transcript:ENSDORT00000011933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVSFTDVTVDFSQEEWERLDPSQRILYMDVMLENYSNLLSVEVWKADEQMEGDPKTPDE
QARQFLILKNQTPVEERGYLFAKTFHLNTDSVSLSQVPYKYSGYEKAAPCRSDLLRDRSY
AGKDDECSGFGKSLLRLKQEKPQSAAEYAEYNKSTKALSPKEVIFKHQKMKNLVQPFVCN
YCDKTFSFKSLLVSHKRIHTGEKPYECNVCQKTFSHKANLIKHQRIHTGEKPFECPECGK
AFTHQSNLIVHQRAHMEKKPYGCGECGKTFAQKFELTTHQRIHTGERPYECSECAKTFFK
KSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHTRTHTGEKPYECTECGKTFSQRSTL
RLHVRIHTGEKPYECADCGKAFSRKSRLSVHQRLHAGDRP
Download sequence
Identical sequences ENSDORP00000011218 ENSDORP00000011218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]