SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011239 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011239
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000384
Family Classic zinc finger, C2H2 0.087
Further Details:      
 
Domain Number 2 Region: 23-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000015
Family HkH motif-containing C2H2 finger 0.038
Further Details:      
 
Domain Number 3 Region: 114-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000506
Family HkH motif-containing C2H2 finger 0.03
Further Details:      
 
Domain Number 4 Region: 318-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000102
Family Classic zinc finger, C2H2 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011239   Gene: ENSDORG00000011958   Transcript: ENSDORT00000011957
Sequence length 469
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3596:10596:236551:-1 gene:ENSDORG00000011958 transcript:ENSDORT00000011957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMATFLRGFEEKGIKNERPEDQLNQEKKKILFSFCEVCNIQLNSAAQTQVHYNGKSHRK
RVKQLSDGQPPPPVQASPNPNDSAGSTCHTSALPALVRTPTLMMQPSLDIKPFMSFPVDS
SSAVGLFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLXXXXXSQAEAHYKGSK
HAKKVKALEATKNKPKMVSSKDSAKANPSCSITPITGNSSDKSEDKGKKANGSSQSSGVD
GGSFLLQSGTTPLQPGAVTSPSKSTNGAPGSVAESEEEKAKKLLYCSLCKVAVNSLSQLE
AHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSEI
QLKQHISSRHKDRVARKPLKPKXXXXXXXXXXXXXXXAKLAFQKDMLKPLAPAFLSSPLA
AAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY
Download sequence
Identical sequences ENSDORP00000011239 ENSDORP00000011239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]