SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011252 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011252
Domain Number 1 Region: 1447-1567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-34
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 2 Region: 930-1036
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 3 Region: 68-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 4 Region: 1618-1737
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-29
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 5 Region: 582-689
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1805-1907
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 2157-2225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-19
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 8 Region: 2513-2578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 9 Region: 2454-2524
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 10 Region: 2631-2688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-16
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 11 Region: 410-468
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000109
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 12 Region: 2214-2271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000297
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 13 Region: 2693-2761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000364
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 2575-2638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2335-2391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 869-933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000364
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 177-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000528
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 18 Region: 7-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 1219-1281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000607
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 20 Region: 1393-1457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 21 Region: 1565-1634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000472
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 22 Region: 1736-1800
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 23 Region: 524-585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000432
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 24 Region: 237-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000445
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 25 Region: 2752-2809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000082
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 26 Region: 1909-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 1142-1212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000157
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011252   Gene: ENSDORG00000011948   Transcript: ENSDORT00000011971
Sequence length 3042
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5908:6740:153106:-1 gene:ENSDORG00000011948 transcript:ENSDORT00000011971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKGGCGDPGIPAYGKRTGSSFLHGNTLSFECQAAFELVGERVITCQQNNQWSGNKPSC
VFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAV
KDDGLSDITVLGTFSGNEVPAQLASSGHVVRLEFQSDHSTTGRGFNITYTTFGQNECHDP
GIPVNGQRFGDRFLLGSSVSFHCEDGFVKTQGSESITCVLQDGNVVWSSTVPRCEAPCGG
HLTASSGVILPPGWPGYYKDSLSCEWIIEAKPGHSIKITFDXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCGGYIHGKSGT
VLSPGFPDFYPNSLNCTWTIEVSHGKVQMVFHTFHLESSHDYLLITEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDLEPCDDPGVPAFSRRIGFHF
GVGDALTFSCFPGYRLEGATRLTCLGGGRRVWSAPLPRCVAECGARVRGNEGTLLSPNFP
SNYDNNHECIYKIETEAGQGIRLSAHGFQLSEGDVLKVYDGKDSSSRLLGAFTKTELLGQ
VLTSTSNHLWLEFNTNGSDTAQGFQLTYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSIASTCNDPGTMQNGTRYGDSREPGDTITFQCDPGY
QLQGQAKVTCVQLNSRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRI
KVNADFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPDRIESSGNSLLLAF
RSDASVGLSGFAIEFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVFGQFAYFQTALSDLAELFDGAHPQDRLLSSLSGSHSGETLPLATSNQILLRFSAKSGA
SARGFHFVYQAVPRTSDTQCSSVPEPRHGRRIGSEFSAGSIVRFECNPGYLLQGSTAIRC
QSVPNALAQWNDTIPSCVVPCSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IQVISFATEQNWDSLEIHDGGDATAPRLGSFSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVGLTACQEPTLPSNGIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVR
RWNYPSPLCIATCGGTLTKLGGVILSPGFPGAYPNNLDCTWRISLPAGYGVHIQFLNFST
EANHDYLEIQNGPYHTSPMIGQFSGSDLPLALLSTTHETLIRFYSDHSQNRQGFKLAYQA
YELQNCPDPPPFQNGYMINSDFSVGQAISFECYPGYVLLGQPVLTCRHGPDRSWNFPFPR
CDAPCGYNVTAHNGTIYSPGFPDEYPVLKDCLWLITVSPGHGVYINFTLLQTEAVNDYIA
VWDGPDQNSPQLGVFSGNTALETAYSSSNQVLLKFHSDFSNGGFFVLNFHAFQLKRCPAP
PAVPHADLIAEDEDFEIGDFVKYQCHPGYTLSGSDTLTCRLSSQLQFQGSVPSCEAQCPA
NEVRTESSGIILSPGYPGNYFNSQTCSWSIKVEPNFNITIFVDTFQSEKQFDALEVFDGS
SGQSPLLVVSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYAAPYCSLPATLRNGG
ILNRTAGAVGSQVHYFCKPGYRMIGLSNATCRRSPAGICQWDSPAPLCQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHCGS
PDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHRWSGQTPVCVPITCGHPG
NPAHGTTNGTEFNLNDLVNFTCNTGYLLHGASRAQCRSSGQWSSPLPACRXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISCGHP
GVPANAVLTGELFTFGATVRYSCEGGQTLTGNSTRVCQEDSRWSGAPPHCSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSCGNPG
TPTNGMISSSDGILFSSSVVYACWEGYRTSGLTTRHCTANGTWTGTAPDCTIISCGDPGT
LPNGVQFGTDFTFNKTVSYQCNPGYLMEPAASATVRCTKDGTWNQSKPVCRAVLCSQPPA
VPHGRVEGADFHWGSSVSYSCADGYQPSHSAILSCEGRGVWKGEVPQCLPVFCGDPGVPA
EGRISGKSFTYNSEVFFQCKSPFILVGSSKRVCQADGTWSGVQPTCIDPAHNTCPDPGTP
HFGIQNSSRGYEVGSTVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIPHACRQPETPA
HADVRAIDLPAFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVRDVNETV
TKTPVPSDVFFVSSVWKGYYEYTGRRQPATLTVDWFNATSSKVNATLTAAPQVQLELTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVASGLERGGFTFQGDVHGKDFGKF
KLERQDPSNSDPDSSSRYHGTSGGSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYNGY
AGHESSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSDORP00000011252 ENSDORP00000011252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]