SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011287 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011287
Domain Number 1 Region: 412-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000307
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011287   Gene: ENSDORG00000012010   Transcript: ENSDORT00000012009
Sequence length 492
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3771:12787:30154:1 gene:ENSDORG00000012010 transcript:ENSDORT00000012009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGVGSLGLHTADSRMAHTMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGI
TLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAMEEDLEEDDGDHILTSELIAE
TVRVPEQVFVADLVTGPDGHLEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAAGGVP
GSTVTIKTEDDDDDDVKSTSEDYLMISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCAEIADEVYMDVTVGAEEGTSLPETQLEDSDVNKTVVPVVWAASYANALDSALE
NRNSTTAQYLQICDSINTNKVLKQKVKKRRRGETRQWQTAVIIGPDGQPLTVYPCHICTK
KFKSRGFLKRHMKNHPDHLMRKKYQCTDCDFTTNKKVSFHNHLESHKLINKVDKTHEFTE
YTRRYREASPLS
Download sequence
Identical sequences ENSDORP00000011287 ENSDORP00000011287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]