SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011305 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000011305
Domain Number - Region: 426-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00478
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011305   Gene: ENSDORG00000012028   Transcript: ENSDORT00000012027
Sequence length 561
Comment pep:novel scaffold:dipOrd1:scaffold_18962:6891:9624:-1 gene:ENSDORG00000012028 transcript:ENSDORT00000012027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSPAGSNPRTPESSGSGSGSGGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLS
AHTGHLLHPEYLQPLSSTPVSPIELDAKNIPLALLAQTCSQIGKPDPPTSSKLNSVAAAA
NELGADKEPGRSEPGCLXDSGSSSVSSTSSSSSASPGDKAGFRVPSASCPPFPPHGAPVS
ASSSSSSPGGSRGGSPHHSDCKNGGGGGELDKKDQEPKPSPEPAAGSRGGGGEPGAHGGG
GGAEAGGSGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQ
FVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHSAS
HLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFML
QNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASSLGSAAAA
AAAAASCHLHLPPPAAPGSPGSLSLRSPHTLGLSRYHPYGKSHLSTAGGLAVPSLPAAGP
YYSPYALYGQRLASASALGYQ
Download sequence
Identical sequences ENSDORP00000011305 ENSDORP00000011305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]