SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011429 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011429
Domain Number 1 Region: 393-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000324
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2064-2112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000023
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 3 Region: 937-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000366
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011429   Gene: ENSDORG00000012154   Transcript: ENSDORT00000012154
Sequence length 2691
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_983:24544:68986:1 gene:ENSDORG00000012154 transcript:ENSDORT00000012154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIEKAQKELNGAEASKKEILEAGVKGASESLKGVKRKKLVTENHLKKIPKSPLRNPLQAK
HKQNTEDSSFAVPQSASESHRRHGYIPAKTGKQFAKQNGETPGIAAEASKSEDSISPKKP
LFLQHPSELRRWRSEGSDPAGLSVLHDNQDSPGKPRTDNSECIPPHGSTGPPSPPLYTNT
AFDVLLKAMEPELSTLSQKGSSCAIKTEKLRPNKTVRSPPKLKNTSVDAPTQPTEDSVAE
SQRSPCTSSTVHGAAAQKNEQASVQPVSHSYNPHGHLVSKPNQHSQQLPCQAGFTASLAN
LQTQEITRLEQVYDTAVTSTTGLTSPSNRTQVTLPNQQVDSALPLSISPANSTQSTPMPI
NNSTHVASVVNQSVEQMCNLLLRDQKPKKQGKYICEYCNRACAKPSVLLKHIRSHTGERP
YPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSQESPKALSVHSDVEDSG
ESDEEGPADGRLNDPGTMELQPGQIMKKTSNSEALPKPGSISGNPDHVAGDFLPQDRPSE
SQGLTELPKVVVHPVNMSPLRTDSPKVINPKSELPNAQRQKDLIQVKSILTHPASVSSTE
EKSHQKGDPSQPEGKQDCHGGTVHAQLQRQQATDYSQEQQGKLLSPRSLGSTDSGYFSRS
ESADQAVSPPTPFARTFLPTEPDSTKNNGPPAPRISAPAPPALPLGEKPLLLAGQMPPPL
ATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPM
GRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPANIIPPPH
PLRGSQSFDDKIGTLYDDVFVSGPNTSVPPSGHPRPLVRQAAVEDSSANENHVVGPGQSL
DEGCQGCPAASEPTAARSKAVAPGSHLEKKKSHQGRGTMFECETCRNRYRKLENFENHKK
FYCSELHGPKTKVXXXXXXXXXXXXXXXXXXXXXXXXXXXGVWEQTPQIRKRRKMKSVGD
DEELQPNESGTSPKSSEALQPQNALGLTPGLSKHVPAMTGEQLRSIQLNTSQVQLTAQAL
EQALDPKLSTIMEQPMTSAAVDKVEVKRQGTGISVIQHTNSLSRPNSFDKLEPLETGSMV
PFQELSRAGKPGSLKVRGIPPEEAHPSRDTSHPHQPASSDTLRGELQESSRKMASDRHVL
GQPSRLVRQHNIQVPEILVTEEPDRDLDTQCHDEEKSEKFSWPQRSETLSKLPTEKLPKK
KRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHASSFSASLDLEDVSKTEATPKIDFPNK
AEFLLIPPGSNTLNVPGSHREMRRAASEQINYMPTLMEVSDFRSKSFDCGSVTLAPSTLF
VESQPSTSPSVAGVTGHVPLLERRRGPLIRQISLNIAPESQLSPVNLPSFQNLALPSVTA
VPCQGLPLPNTSSAEFPTNTLHSQIQAKDLPAHTLNSNSTAIFPVQQLFSINVLNQTHVP
LSQQNTQLPPPVFAKEDKTDMYPTIHVSSTSKDCFAPKYQLQCQAFPSGQASCSNPTHPL
PSQVLPDADRADQGTTSVALPVKLVDPMSKGSSLLSLELGPLGNQVQKAPSSFMLPVHLQ
SHIPTYCFATLTSLPQILVTQDLSNTSICQTNQSLVPISEELNSMPTSQKDHHNALPNPE
KDLVCKNVFSEIGQQSSLSESLPLTQKMSVGRLSPQPESSASSKRMSPANSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSSGHAKIVIRDNNELQEENIKSSTSLSLPDQNPVPPENTHHIS
PLKSVNSNQERAPSGLINQGDKVSILGQNKLPVTTLPLPSTGDTQQLPLPSLKTATSFTW
CYLLRQKALPLPQKDQKTSAYTDWTVSSNNPNPLGLPTKVALSLLHSKQKTGKSLYCQAI
TTHPKSDLLVYSSKWKNNLSKRALGNQKSTIVEFSNKDASEINNEQDKENSLFKSEPRRI
KIFDGGYKSNEEYVYVRGRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCTYCNFS
FKTKGNLTKHMKSKAHSKKCVDLGVSVALIDEQDTEESDEKQRFGYERSGCDLEDSDGPD
EDDNDNEEDDEDSQAESVLSATPSVTASPQHLPSRSGLQDAGSVDEDLRISECFSGSHTD
PMDVLPRALLTKMTVLSTVQSEHSRKTNAPATPRQQAAKDEEEMAPSRDDSRSPRSPCYQ
MFVDYPESEVVSGSVAGKAVTSTQDMPLVRLSPATVELSPQPTASIASPALPHPDTQDQK
QQTTPHPPPGLPSPQTHLFSHLPLHSQQQSRTPYNMVPVGGIHVVPAGLTYSTFVPIQAG
PMQLTIPAVSVIHRTTGTPGDTITEVAGTTNPPGVPELSSVVPCFPIGQIRVPGLQNLAT
SSLQSLTSLSMETVNIVGLANTNITPQVHSPGLALNAVGLQVLTANPPPQSSPAPPAHIP
GLQILNIALPTLIPSVGQVTVEASGASEVPAAHSKAAEMQPKQTPAASLSQVSRTESPRG
SAKVLQENAKKVLGPSAPAGDQARLDGASKTDSERAILGNHTKPTPELTSLPVPAALQKA
RGKALGKPSGLHTLSPDRQVHRPPAPPSRPPTVHFSDVSSDEDEDRLVIAT
Download sequence
Identical sequences ENSDORP00000011429 ENSDORP00000011429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]