SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011440 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011440
Domain Number 1 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000025
Family Classic zinc finger, C2H2 0.0000899
Further Details:      
 
Domain Number 2 Region: 284-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000121
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 194-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000149
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 4 Region: 437-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000222
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011440   Gene: ENSDORG00000012164   Transcript: ENSDORT00000012165
Sequence length 564
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6497:86:29934:1 gene:ENSDORG00000012164 transcript:ENSDORT00000012165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRLGAVPATPGPTSLKLQRSARIVGAKNSRTQCAIKDKSFQYTIPHDDSLNVSSSASS
GEPMDFPASQKSTYWRKMKRIKSAATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRKQRPKTQPNPKSQTRRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTI
EGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSCSSTFTSIMGYLYHVRKCGKGAAELEKLALKCHHCGKPYRSKAGL
AYHLRSEHGPITFFPETAQPECLKEVSLESKSGGRVQRRSAKIAVYHLQELASAELTKEW
PKRKVLQDLVPDDRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCEAVYCSVSG
LKAHLGSTWGNFVAGKYRCLLCQKEFVSESGVKYHINSVHAEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRQQPSIEPPETPLSLRGGTDQRGNDEELVMSTSCKES
EQEPVPAPSQKVKAPKTTHKRGRK
Download sequence
Identical sequences ENSDORP00000011440 ENSDORP00000011440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]