SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011514 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011514
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.48e-24
Family Ankyrin repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011514   Gene: ENSDORG00000012247   Transcript: ENSDORT00000012247
Sequence length 215
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6104:17383:30302:-1 gene:ENSDORG00000012247 transcript:ENSDORT00000012247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI
CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICLAKRRGVNKDVIRLLE
SLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED
LGFWRVLLLIFVIALLSLGIAYYRSARQDRSTQAM
Download sequence
Identical sequences ENSDORP00000011514 ENSDORP00000011514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]