SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011519 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011519
Domain Number 1 Region: 454-533
Classification Level Classification E-value
Superfamily RING/U-box 1.83e-19
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Domain Number 2 Region: 634-683
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-16
Family RING finger domain, C3HC4 0.0011
Further Details:      
 
Domain Number 3 Region: 190-323
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000116
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011519   Gene: ENSDORG00000012252   Transcript: ENSDORT00000012252
Sequence length 1212
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_8:26672:125224:1 gene:ENSDORG00000012252 transcript:ENSDORT00000012252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATAREGWGAPAGSEPRHRLRLSPGFARASRARPGPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLARPVEDDFRRAD
CLQMILRWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVELLVKHGGDLFAEN
ENKDTPCDCAEKQHHKDLALNLESQMVFSRDPDAEEIEAEYAALDKREPYEGLRPQDLRR
LKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMCNPENCCQRSGVQMPTPPPSG
YNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDF
CRGCWESFLNLKIQEGEAHNIFCPAYDCFQLVPVDIIESVVSKEMDKRYLQFDXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECLGEAHEPCD
CQTWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQC
AKCKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGGCPDTTFIEDAVHVLLKTR
RILKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLV
QQKRQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQQRR
RGDVHSLLSNPPEADEPSESTLDIPESGSGRRPGASVVSSASMSVLHSSSLRDYTPASRS
ENQDSLQALSSLDEDDPNILLAIQLSLQESGLTIDEETRDFLNNEASLGAIGTSLPSRLD
SVSRNTDSPRAALSSSELLEFGDSLMRLGAESDPFSTDTLSSHPLSEARSDFCPSSSDPD
SAGQDSNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQYPRDKDESEGVRNMELV
PPEEDSVFDAAVSESGGIQIEENPLEENILAVETLAQAAESNIEAANKGNGSDASSQTPQ
TSRDWLDQVHLV
Download sequence
Identical sequences ENSDORP00000011519 ENSDORP00000011519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]