SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011522 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011522
Domain Number 1 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000013
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 388-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000215
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011522
Domain Number - Region: 359-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000489
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 475-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00107
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 4-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00955
Family LIM domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011522   Gene: ENSDORG00000012257   Transcript: ENSDORT00000012256
Sequence length 538
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4357:1188:11912:1 gene:ENSDORG00000012257 transcript:ENSDORT00000012256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCRLCHGKFSSRSLRSLSAQAPGERAERPSSGEPLFIRDFQSLLGVAVLRDPALPQFV
CKNCYSQFYQCHSLLRSFLQRVNAFPTGPRNPCSKTGAQLPTVAEEGACLVDLITSSPRC
LHGLVGWVHGHATTCRALPSLRGTLTSEYYGIIQTVWGCGQGHDYTMDMDASRRAPLLDR
ALAVKWVRDKETIPRRAQDLRSNPTGAASQLYQGRGTTAGAETKMLPTLDKAPPPSEDNS
LGPGPGPQSQPSLAPSEAPGQLGEKQVPSPTSDDRVKDEFSDLSEGDFLSEEENDKKQNT
QSSDESFEPYPEKKVSGKKQESKEAKKAEEPKIRRKPGPKPGWKQQLRCEREELPTIYKC
PYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVRNY
ICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAEAELDFAC
DQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPLPGPPSCSGTTKSQDMKPEPT
Download sequence
Identical sequences A0A1S3GT60
XP_012891127.1.60039 ENSDORP00000011522 ENSDORP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]