SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011579 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000011579
Domain Number - Region: 17-42
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.011
Family Ankyrin repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011579   Gene: ENSDORG00000012318   Transcript: ENSDORT00000012318
Sequence length 848
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_559:7339:87615:-1 gene:ENSDORG00000012318 transcript:ENSDORT00000012318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSE
VDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQ
QCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKEFVAQPN
CQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIK
FICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGG
FTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEALFAISN
ILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRA
IDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFG
TYNVISLVVLLNMLIAMMNNSYQLIAXXXXXXXXXXXXXXXMSYFDEGGTLPPPFNIIPS
PKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSFRYEVLDLLGNRKPPKRSFSTSSTELSQRDDTND
GSGGARAKSKSVSFNLGCKKKACHGPPLIRTMPRSSSAQGKSKAESSSKRSFMGPSFKKL
GLLFSKFNGHMSEPSSEPMYTISDGLVQQHYMWQDIRYSQMEKGKAEACSQSEINLSEVE
LGEVRGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQ
EEQVTTRL
Download sequence
Identical sequences ENSDORP00000011579 ENSDORP00000011579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]