SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011587 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011587
Domain Number 1 Region: 606-773
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-37
Family Ankyrin repeat 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011587   Gene: ENSDORG00000012326   Transcript: ENSDORT00000012326
Sequence length 783
Comment pep:novel scaffold:dipOrd1:scaffold_5078:42033:48896:-1 gene:ENSDORG00000012326 transcript:ENSDORT00000012326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKFALNQNLPDLGGPHLCTVPSGSARSPSSPYSVETPYGFHLDLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXREQRALRAEKAQLLAVRAQQPEADEETEARP
DKLAQLRRLTERLAIPDRGVRSRASLRADSSDGLAARRSEGSLQILDGAALIPDGAPQIQ
EAGTEALYQTRETGTQAVPEIREAGVDAVPKTVEADAWVTESLLGLPEAAERELELLRAS
LEHQRGVSELLQIRLQELEARMAVEVDEALETGSQPREAATQTPWVCAEKTTQTESTALT
LENLPGPMSADKAEAPASTLKSIMKRRDGTPSAQSSPGPKSLKFVGVSNGKYESSSSDDS
DIEGNAEPPQNNSSDTGDESGRDSDPDTPGPPNEDAEGDTEPEAQSEPQPESQERCELSP
RLREACIALHRQLSRHRGGTRDGSAARLVAQEWFRVSSQRRSQAEPVARMLRGVVSLGPE
LLAHVVNLADGNGNTALHYSVSHGNLAISSLLLDTGVCEVNQQNRAGYSALMLAALTSAR
QEEDMTVIQRLFSMGDVNAKASQTGQTALMLAITHGRQDMVAALLECGADVNTQDADGAT
ALMCASEYGRLDTVRLLLAQPGCDPAILDNEGTSALAIALEAEQDEVAALLHAHLSTSQP
DSQ
Download sequence
Identical sequences ENSDORP00000011587 ENSDORP00000011587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]