SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011591 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011591
Domain Number 1 Region: 901-951
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000466
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011591
Domain Number - Region: 1228-1274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0369
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011591   Gene: ENSDORG00000012332   Transcript: ENSDORT00000012330
Sequence length 1292
Comment pep:novel scaffold:dipOrd1:scaffold_278:26925:215212:-1 gene:ENSDORG00000012332 transcript:ENSDORT00000012330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNVASESEGQTLEPIGTESKVSGKNKEFSADQMSENTD
QCDSAELNNKEEHILHGQDQSSSSKKDLKSSVLSEKAGFNYESPSKGGNLPSFPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEDHKMSPKATEETGQV
QSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVL
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSDGAKPSEKNSSKSIPALRGSEPGDLGKWQDKITVKAGD
DTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGSVQSGGL
NPELNDKLPRGSVINQNDLAKSAEGEPMTKAEKGSSGAKKKDFSSKGAEDNMVTSYNCQF
CDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFAC
RKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFSTPDVDVLLFHYETVHESQVSDVKQE
ANHLQGPDGHPSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCQCSFTAADTQSLL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR
RRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRR
TRKRLNPEALQAEQLNKQQRGSSEEQVNGSPLERRSEDHLSEAHQREIPLPSLSKYEAQG
SLTKSHSSQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNTSSISEGKGSSERGSPI
EKYMRPAKHSNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYL
SHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTSNGASKEKTKAP
PNVKSEGPLNVVKTEKVDRSTQDELSTKCAHCGIVFLDEVMYALHMSCHGDSGFQCSICQ
HLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE
Download sequence
Identical sequences ENSDORP00000011591 ENSDORP00000011591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]