SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011592 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011592
Domain Number 1 Region: 714-833
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-32
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 1937-2044
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-31
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 2275-2394
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1420-1520
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-28
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 5 Region: 547-657
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 2463-2567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1239-1348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 3169-3240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-20
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 9 Region: 241-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 65-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-20
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 11 Region: 2931-2997
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.09e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 12 Region: 2756-2825
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 13 Region: 2815-2871
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-16
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 14 Region: 3229-3298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 1631-1694
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000109
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 16 Region: 2222-2291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 17 Region: 484-555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 3288-3344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2629-2696
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000043
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 3349-3416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 21 Region: 2567-2640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1008-1068
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 23 Region: 1699-1764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000971
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 1876-1942
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000106
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 25 Region: 893-938
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000131
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 26 Region: 662-721
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 1060-1181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000157
Family Spermadhesin, CUB domain 0.0053
Further Details:      
 
Domain Number 28 Region: 2986-3047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000054
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 30 Region: 1181-1243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000058
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1352-1414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000013
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 3407-3465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 33 Region: 833-901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 2703-2767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 35 Region: 2393-2456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000702
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 36 Region: 2109-2146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000072
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 37 Region: 1760-1797
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000275
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011592   Gene: ENSDORG00000012327   Transcript: ENSDORT00000012331
Sequence length 3704
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4805:4543:689763:-1 gene:ENSDORG00000012327 transcript:ENSDORT00000012331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRIRNGGSRAQESKSREPGSRGCAKCGRRDSILSKNMGIKSGFTFWNLVFLWTVSCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPANFRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQSSSCGN
PGIPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTLRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTLTHTTSTGELEEHN
TTTTGALAVASTPADVTVSSVTAVTIHRLSEEQRVQVTNLRNSGLDPNTSMDGLSPHEAD
TQSTKRRPRNAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSLLNEGGIKT
ASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHRP
VCKVKTCGCNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGYD
TLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIEK
ESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFPC
LSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDGD
SPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIPI
NARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGPIPRCGAPCGGHFSA
PSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTVNTYSCLDPGIPVHGRR
YGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILSP
GYPEFYPNSLNCTWTVDVTHGKXXXXXXXXXXXXXXXXXXXXXXXGSFTQPLARLTGSDL
PSTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGNRVGFSFGVG
DTLTFSCSLGYRLEGSSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLNY
ENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTLS
STSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYGC
NPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLRC
MWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNIV
TIQFDTDFYISKSGFAIQFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAFRSD
GSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLTC
IMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVLFECNPGYILHGSTTIRCDTV
PNSLAQWNDSLPSCIVPCGGVLTKRKGTILSPGYPEPYDNNLNCIWKITVPEGAGIQVQV
VSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGFH
LEYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHSHITCMPGPVRRWN
YPIPICLAQCGGSMSDFSGVILSPGFPGNYPSSLDCTWTIKLPIGFXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQL
QSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLMGNSALTCLHGVSRNWNHPLPRCEA
LCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTVLQTEPIYDFITVWD
GPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPPV
PNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANEL
RLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNISMFIEFFQTEKEFDVLQVYDGPNIQ
SPVLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYII
SQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTNG
GILTTDYLVGTRVTYFCNDGYRLSSKELTTAACQSDGTWSNHNKTPRCVVVTCPSINSFT
LEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQIISCGE
LPTPPNGNKIGTQTSYGSTAIFTCDSGFMLVGSAVRECLSSGLWSGSETKCLAGHCGIPE
LIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNCSDPGIPAN
SKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGQPGGS
SNAVLSGEKYTFGATVHYTCTGKRSLLGQSSRTCQLNGHWSGSQPHCSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPECKAVQCNPGTTAN
GKVFRVDGTTFSSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISCGDPGIPANG
LRYGDHYVVGQNVSYMCQPGYTMESNGSRSRTCTTNGTWSGVMPTCRAVTCSAPPQISNG
RLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPSQGKR
EGKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHCIEPTRTSCDNPGVPRHGS
QNHTFGFQGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECLPHSCKQPETPAHANVV
GMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPICEAGSKILVKDPRPALGT
PSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNATLSNSNMELLLSG
IYKSQEARLMLHIYLIKVPPHVSVKKMKEENWAMDGFVCVEPDGATYVFQGFIQGKDYGQ
FGLQRLGLNMTEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYT
GCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences ENSDORP00000011592 ENSDORP00000011592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]