SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011611 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011611
Domain Number 1 Region: 272-427
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.08e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000698
Further Details:      
 
Domain Number 2 Region: 428-592
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 145-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 4 Region: 33-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 5 Region: 639-791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-26
Family MAM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011611   Gene: ENSDORG00000012348   Transcript: ENSDORT00000012350
Sequence length 928
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2122:41435:167437:1 gene:ENSDORG00000012348 transcript:ENSDORT00000012350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMVPLTWVFLALYFSGQEVRGQPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWVVYAPE
PNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSTLYIK
FTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILATP
KMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGRYCGTRTPSELRSSTG
ILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYTDKR
WTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKL
EVSTNGEDWMVYRHGKNQKVFQANNDATEVVLNKLHTPLLTRFIRIRPQTWHSGIALRLE
LFGCRVTDAPCSNMLGMLSGLIADSQISASSTREYLWSPSTARLISSRSGWFPRIPQAQP
GEEWLQVDLGAPKTVKGVIIQGARGGDGVTPVEARAFVRKFKVSYSLNGKDWEYIQDPRT
QQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDLQLPSGFNCNFDFPEEPCGWMYDHAK
WLRSTWTSSTSPNDRTFPDEKNFLRLQSDGRREGQYGRLISPPVHLPRSPVCMEFQYQAT
GGHGVALQVVREATQESKLLWVIREDQDGEWKHGRIILPSYDLEYQIVFEGVIGKGRSGE
IAIDDIRISTDVPLEHCMEPISAFAGEDFKVDIPEIHGGEGYEDEIDDDYEVDWSNSSSP
TSGAGSPSADKEKSWLYTLDPILITIIAMSALGVLLGATCAGLLLYCTCSYSGLSSRSCT
TLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences ENSDORP00000011611 ENSDORP00000011611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]