SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011618 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011618
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.03e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 436-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 400-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 215-252
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000017
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 
Domain Number 5 Region: 478-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000175
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011618   Gene: ENSDORG00000012359   Transcript: ENSDORT00000012358
Sequence length 539
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_68:330884:345842:-1 gene:ENSDORG00000012359 transcript:ENSDORT00000012358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTDLGQALGLLPPLAQAEDSLFSGPDAASQGELSSPEAARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPRRLWQWISIQVLGQEILSEKKASPWDAEPLPEVEHQEQGLESSPLDPGELLGHTVKE
EPELAVAASQIPARPEDRLLGDQDLGAVLLPGTPQDQWRHLDSTQKEQYWDLMLETYGKM
VSGAGVSTSKPNLPXXXXXXXXXXXXXXXXXXXXXXXXXXXERQENDKEILNLADHRGLK
LWKACQASGEAPPQAALRGFFSEEDMPGCFVEGERLPEAPENLQGEGSGGQISPHARSSG
KQLGHYLPPPPGELSALWLEEKKEASQKEQLRAPLAPKLPTCRECGKTFYRNSQLVFHQR
THTGETYFQCPICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLRHHEKIHTG
KKPYKCPIVKSIIQRSNFTRHPRVLTGEKPYKESQSGKKITGSSSPNKHQSSIRKRPFQ
Download sequence
Identical sequences ENSDORP00000011618 ENSDORP00000011618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]