SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011634 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011634
Domain Number 1 Region: 70-177
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.31e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.007
Further Details:      
 
Domain Number 2 Region: 570-654,696-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000104
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011634   Gene: ENSDORG00000012374   Transcript: ENSDORT00000012374
Sequence length 909
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3608:7836:28544:-1 gene:ENSDORG00000012374 transcript:ENSDORT00000012374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSPSPVSPDHEASMGHDPRSPLEPEAQDSYRLFARRDRPVTPGEEDEGSEANLQDRNL
KRNYIELVQGMQEWQDGCVYRGEFGLDMKLGYGEFSWPTGEYRGQFYRDHCHGVGTYTWP
DGSSFTGMFYLSQREGYGTMYMKTRLFQGLYKADERFGPGFETYPDGCQDVGLWFREHLV
KLCMDIPSSFCLLSYPEFSAFLTQCQERLSLSEEERAEWHPTEEQDPFFYEYKRFLVSDD
LTLPPEMHIYSTDNQHLPMPDSFRRELDAQVFHNEIPPFIEDGEPWFIQNQTPLLIKIQK
QAYKFRHKKAHSSWNMDAILQGNRSGFARRGPKERLSKEMILKAEAGDYDWIYGMLKDNL
VHVDVADSKGYTVLAAAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEIPTFLSASKYSNLESIYEANDMVSSSEERKAAISSGLEDQSPSSML
RWDSSSRRSLGDLEQVVEESEGNISTIYSTTETNFESSLCVRNYTIQLSRDILEKSAEAY
SMLQPPLFDKGTMRKMAQSMHEHRSLWMTIQLLLCRGADPNLCQVPMQALFLAVKAGDVE
GVKLLLESGARTDIQYPPQLRSLTPLHIAVSLPGEEGVKITELLLHAITNVDAKATDQDE
VYKASKLDLLPSSLKLNNELGPPSSYYTAVPTCVPEEGGRTALHVACEREDSRKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMGSIHRLKKSS
SPSKAVEKE
Download sequence
Identical sequences ENSDORP00000011634 ENSDORP00000011634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]