SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011647 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011647
Domain Number 1 Region: 15-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.49e-19
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 264-359
Classification Level Classification E-value
Superfamily Nudix 0.000000000000059
Family NADH pyrophosphatase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011647   Gene: ENSDORG00000012388   Transcript: ENSDORT00000012388
Sequence length 462
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1837:15848:23333:-1 gene:ENSDORG00000012388 transcript:ENSDORT00000012388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVKSSPKQEIISQLHNSAAEGDIGKLTGILHHFPSLLNETSENGWTALMYAARNGHPD
VVQLLLEKGCDRSIVNKSRQTALDIATFWGYKHIANLLANAKGGKKPWFLTNEVEEGENY
FSRTLLDRKSEKRNNTDWLIAKESHPATVYILFSELNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEMKKKLNNYNGEVPREEDDGLVAWFALGIDPMAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATKIEEGGYKR
VCLKEDCPSLQGVHNTSYPRVDPVVIMQVAHPDGTKCLLGRQKRFPPGMFTCLAGFIEPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVVDILTKGKQQKFFVPPSRAIAHQLIKHWIGMNPNL
Download sequence
Identical sequences ENSDORP00000011647 ENSDORP00000011647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]