SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011689 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011689
Domain Number 1 Region: 1247-1443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.42e-35
Family Pentraxin (pentaxin) 0.0016
Further Details:      
 
Domain Number 2 Region: 1963-2032
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2649-2718
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2315-2384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.53e-18
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 2707-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 3055-3119
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 2591-2659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 2198-2268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 9 Region: 2083-2147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.26e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 10 Region: 2533-2602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1609-1678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-16
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 12 Region: 2487-2544
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 2373-2440
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 2881-2949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.15e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 15 Region: 2257-2326
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 1505-1567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.00053
Further Details:      
 
Domain Number 17 Region: 5-82
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000223
Family Integrin A (or I) domain 0.0064
Further Details:      
 
Domain Number 18 Region: 2765-2830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000702
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 260-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 20 Region: 1450-1522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 2825-2891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000567
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 22 Region: 199-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000118
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 23 Region: 2021-2086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 24 Region: 2141-2208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 25 Region: 1203-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000116
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 26 Region: 1090-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000659
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 27 Region: 1902-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000667
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 1165-1208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 29 Region: 1128-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 30 Region: 1016-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000619
Family EGF-type module 0.011
Further Details:      
 
Domain Number 31 Region: 1052-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000198
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 32 Region: 1563-1606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.046
Further Details:      
 
Domain Number 33 Region: 834-966
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 34 Region: 320-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000032
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 35 Region: 100-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000293
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 36 Region: 1778-1816
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000302
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 37 Region: 3110-3167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000792
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011689
Domain Number - Region: 1864-1905
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000306
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number - Region: 3318-3349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1667-1702,1755-1781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000919
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number - Region: 3349-3380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 549-602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00195
Family Complement control module/SCR domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011689   Gene: ENSDORG00000012431   Transcript: ENSDORT00000012432
Sequence length 3385
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6597:31435:165512:-1 gene:ENSDORG00000012431 transcript:ENSDORT00000012432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILQHARENSTKVIFLITDGYSNGGDPRRIAASLRDAGVEIFTFGIWQGNIRELNDVAST
PKEEHCYLLHSFEEFEALARRALHEDLPSGSFIQEDMSHCSYLCETGKDCCDQMASCKCG
THTGQYECICEKGYYGKGLQHECTACPSGTYKPEALPGGISTCISCPDENHTSPPGSTAP
EDCVCKEGYRASGHTCQVVHCPALKPPENGYFIQNTCKNHFNAACGVRCRPGFDLVGSSI
LLCLPNGLWSGSESSCRVRTCPRLHQPKHGQISCSSGEMSYNTTCLIACDEGYRLEGSAK
LTCQGNAQWDGTEPRCVENYCPTFQKPKGVILNPFNCGKQPAKPGTQCHVVCRPGFVLSG
VREVRCTTSGKWSAKIHTTACKDVKAPQINCPQDIEAKTQEQQDSANITWQIPTAIDNSG
EKVSIHVHPTFTPPYLFPIGEVAITYTATDLSNNHASCTFYIKVIDEEPPVIDLCRSPPP
IQTSEKEYIASWDEPQFSDNSXXXXXXXXXXXXXXXXXXXXTVVQYTATDPSGNNRTCDI
HIVIKASPCEVPFTPINGNFTCAQDSAGVNCTLSCLEGYDFTEGSTEHYYCAFEDGIWKP
PYSTEWPDCAIKRFANHGFKSFVTLYKATRCDDVDLLRKFSEAFETTLGKMVPSFCSDAD
DIECRLEDLTKKYCLEYNYDYDNGFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCPLGTHYSLEHSACESCG
IGSYQDEEGQLRCKPCPPGTRTEYLHSRSISECKAQCKQGTYSSNGLETCESCPLGTYQP
EFGSQSCLLCAEPTTTVKRGAVNFSACGVPCPAGEFSRSGLMPCHQCPRDYYQPDPGKSF
CLSCPFYGTTTFAGARSISDCSSFSSSFSAAEESDMFFNSPGSKEKKYEVGSQVFHECFL
NPCHNSGTCQQVGHGYVCQCTPGYTGLKCETNIDECSSMPCLNHGICKDQVAGFTCECSL
GYAGQLCEENINECSSSPCLNKGICVDGLAGYDCTCMKGYTGVHCEAVNECQSNPCLNDA
ACEDQVGGFLCKCPPGFLGTRCEKNINECLSQPCQNGATCKDGANSFRCQCAPGFTGPHC
ELNINECQSNPCRNQATCVDKLNSYSCKCLPGFSGSRCETEQSTAFNMDFEVSGIYEYVI
LDGVLPALQEVTCAFWMKSSDSINYGTPISYAIEDDNANTFLLTDYNGWVLYVNGKERIT
NCPPVNDGSWHHIAVTWTSSGGAWKVYIDGKLSDSGSGLSVGTAIPGMFGGGALVLGQEQ
DKKGEGFNPAESFVGSISQLNLWDYVLSPQQVKLLATSCSEELSRGNVLAWPDFLRGVIG
KVKTSSKSIFCSDCPSLEGSVPHLKAASGDVKPGSKVSLFCDPGFQLVGNPVQHCLNQGQ
WTQPLPHCESIRCGVPPPLENGFYAEDFHAGSTVTYQCNPGYYLLGDSRMFCTDNGSWNG
ISPLCLDVDECAVGSDCNEHASCLNINGSYICSCIPPYTGDGKTCAEPVKCKAPGNPDNG
LSSGEIYTVGAEVTFSCEEGHELVGVTKITCLETGEWNHLRPYCEAVSCGVPAAPENGGV
DGSTFTYKSKVTYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLQGPSRIECTASGNWDRAPPTCQLVFCGEPPAIKDAVITGSN
FTFGNTVTYTCKEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGDIAYYCADGYSADNSQLCNAQGKWIPPEGQAVPRCIAHFCEKPPSVSYSILESVSKAK
FAVGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPLSIQCIPVRCGEPPRIMYGYASGSN
YSFGAMVAYSCHKGFYIKGEKKSTCEATGQWSSPIPTCHPVSCNEPPKVENGFLQHTTGR
IYESEARYQCNPGYKSVGNPLFVCQANRHWHSESPLVCVPLNCGKPPPIQNGFMKGENFE
VGSKVQFFCHEGYELVGDSAWTCQKSGKWSKKPSPKCVPTKCPEPPLLENQLILKELTSE
VGVVMFSCKEGHALQGPSVLRCLPSQQWNDSFPVCKMVLCLPPPLISFGGPVPSSTLHFG
STVKYSCVDGFFLRGSPNTICQADGTWSSPLPECVPVECPHPEEILNGIIDVQGLAYLST
ALYTCKPGFELVGNSTTLCGENGDWIGGKPTCKPIECPKPKEILNGKFSSTNLHYGQTVT
YSCDEGFRLEGSKALTCLETGDWDMAAPSCSAIHCNAPQPIENGFVEGADYRYGAMIIYS
CFPGFQVSGHAMQTCEESGWSSSIPMCVPIDCGLPPHIDFGDCTEVKDGQRYFDQEDDMM
EVSYLTPRPHPSGAESKSWDNVKESSSTHSSHFLYGTMVSYTCNPGYELLGNPVLICQED
GTWNGSAPSCISIECDLPVAPENGLLHFTQTTMGSAVQYSCKPGHILVGSDMRLCLQNRK
WSGASPHCETIACTKPNPIMNGSIKGSNYTYLSVLYYECDPGYVLNGPERRTCQDNKNWD
GHEPICLPVDCGSPPVSANAQVKGEEYTFGGEIEYTCNEGFLLEGARSRACLADGSWSQA
TPKCIPVRCAPPPQVANGVMDGRDYGFKKEVLFRCQEGYVLHGAQKITCQSNGTWDAEIP
LCKPVTCGPPEDLPQGFPNGFSFYHGGHIQYQCFPGYKLHGSPSRRCLSNGSWSGSPPSC
LPCMCSTPIIHYGTINGTDFGCGKTAQIQCLKGFKLLGLSEITCEANGQWSSEFPHCEHT
SCGSLPTIPNALISESSNSEETVVTYRCRSGYVMQASSNLICTEAGIWSHPYPVCEPLSC
GPPPFVANAVATGETYTYESEVKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGYTYEGIVSCQLDGTWAPPFSDESCIPVSCGHP
ESPEHGYVIGSNYSFESTIIYQCEPGYELEGNRQRVCQENRQWSGGVVTCKKSSCEAPAE
FDGNAVVENSTGGPRVVYSCHRGYSLEPLEAHCTDNGTCSHSVPLCKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXICILPCLNGGRCVAPYQCDCPSGWTGSRCHTATCQSPCLNGGKC
VRPNRCHCLSAWTGHDCSRKRRTGF
Download sequence
Identical sequences ENSDORP00000011689 ENSDORP00000011689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]