SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011693 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011693
Domain Number 1 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 320-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000162
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 229-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000179
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 372-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000864
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011693   Gene: ENSDORG00000012437   Transcript: ENSDORT00000012436
Sequence length 424
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4408:11814:37776:1 gene:ENSDORG00000012437 transcript:ENSDORT00000012436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSPSGKGPSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPP
TSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQSVPQPDVALHARPATSTVTGLGL
SSRTPAVSTSESSTGNGTGTGTGTGTSTPSTPTTTSQSRLIASSPTLISGITSPPLLDSI
KTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRCKVCPLTF
FTKSEMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLS
HLQQHTXXXXXXXXXXXPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASL
QIHLSAHAIKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPVR
ISLI
Download sequence
Identical sequences ENSDORP00000011693 ENSDORP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]