SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011837 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011837
Domain Number 1 Region: 1159-1433
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.93e-48
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 252-392,468-537
Classification Level Classification E-value
Superfamily L domain-like 5.78e-27
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.064
Further Details:      
 
Domain Number 3 Region: 3-144
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000142
Family Ankyrin repeat 0.0039
Further Details:      
 
Domain Number 4 Region: 563-654
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000318
Family G proteins 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011837
Domain Number - Region: 1566-1688,1828-1884
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0523
Family Putative isomerase YbhE 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011837   Gene: ENSDORG00000012588   Transcript: ENSDORT00000012588
Sequence length 1937
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4127:455:44026:1 gene:ENSDORG00000012588 transcript:ENSDORT00000012588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLLSIAAAHGDVETVRYLLSEKHVEMPTEPTDDNPAVVATHFGHTEVVQELLGGQPVAI
SAVTVLSPPPGPCSPQRLLNWMLALACQRGHLGIVKLLVLSHGADPESYAVRKNEFPVIV
RLPLYAAIKAGNEDIAIFLLRHGAFFCSYILLDSPDPSKHLLRKYFIEASALPSSCPEKT
ALRVRWSHLRLPWVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
GELPCVRSSEEIICSRLLEIDISSNKLSHLPPGFLHLSRLQKLIASKNYLEKLFEEENAT
NWIGLRKLQELDVSDNRLTELPALFLHSFKGLTHLNVSRNNLKVFPDPWACPLRCCKASK
NALAALPDKMAVFWKNHLRDVDFSENALKEVPLGLFQLDXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMLEFPAFLGDTLEVLY
LNDNHLDAVPPSVCLLKNLSELYLGNNPSLRELPPELGQLSNLWQLDIEDLQVGNVPADV
RKEGPKAVLSFLRAQLRQAERCRLMKMIIAGPPRQGKSTLLEILQTGRAPQGTHGEATIR
TTKWELQRPAGSKAKVESVEFNVWDIGGPTSMATVNQCFFTDKALYVVVWNLALGEEAVA
SLQFWLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYLLPHLLPSKPGLDIHSMRHRANAIQRVFKMSFVPVGFWQRFIARM
LVSLAEMDLQLFENKKNTRGRNRKVAIYSFTGNQRNRCSTFRVKRNHTIYWQEGLLVTFD
GGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITDHVNSLIDQWFPALTATESDG
TPLMEQYVPCPVCEVSWAHHTDPGEKSEGVQYFDMEDCVLTAIEKDFISCPRHPDVPVPL
QELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRARYQSQPVAVKRFHIK
KFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVSLIGISIHPLCFALE
LAPLSSLNTVLSENAKDASFMPLRHMLTQKIAYQIASGLAYLHKKNIIFCLKSDNILVWS
LDVKEHVNIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSFGMVLYE
LLSRQRPALGHHQLQIAKKLSKGIRSVLGQPEEVQFHRLQALMIECWDTKPEKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYTVVNTEKGLLEVQR
MTCPGMKLSCQLKVQNTLWTATEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXNSLLVLAGLADGLVAVFPVARGTPRDGCSYLCSHTANRAKFRIADADARQNPYPVSAM
EVANSGTEVWYSNGPGLLVIDCGTLDIRRRLEPYAAPSVVTAITCSSDCRGEEVVWCLDD
KANALVMYHAATYHLCAQYFCGDPSPLRDVFPVQLVGVESLGGHTPSSKETEGDPIADVS
IIYSKELGTQILSHQDSLTDYCSMSSYSSSPPHPATRSLSSCPNSPASGSSVPFSTDYED
SDRMPEPGVISDRSDPDLTPLDGETFSQHLQAVKVLAVRDLIWISRRGGDIIVISMEKES
GAQRGRVIAVLKARELTPHGVLVDAAVISKETVVCCFENEASEWCLAVWRGWGAKEFDIF
YQSYEELGRLEATRKRR
Download sequence
Identical sequences ENSDORP00000011837 ENSDORP00000011837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]